Rocksolid Light

Welcome to RetroBBS

mail  files  register  newsreader  groups  login

Message-ID:  

The more they over-think the plumbing the easier it is to stop up the drain.


computers / alt.usenet.offline-reader.forte-agent / Re: Puzzle arising re BT ceasing POP support

SubjectAuthor
* Puzzle arising re BT ceasing POP supportTerry Pinnell
`* Re: Puzzle arising re BT ceasing POP supportRalph Fox
 `* Re: Puzzle arising re BT ceasing POP supportTerry Pinnell
  `* Re: Puzzle arising re BT ceasing POP supportRalph Fox
   +- Re: Puzzle arising re BT ceasing POP supportTerry Pinnell
   `* Re: Puzzle arising re BT ceasing POP supportTerry Pinnell
    `* Re: Puzzle arising re BT ceasing POP supportRalph Fox
     +* Re: Puzzle arising re BT ceasing POP supportNobody
     |`* Re: Puzzle arising re BT ceasing POP supportTerry Pinnell
     | `* Re: Puzzle arising re BT ceasing POP supportNobody
     |  `* Re: Puzzle arising re BT ceasing POP supportTerry Pinnell
     |   `- Re: Puzzle arising re BT ceasing POP supportNobody
     `- Re: Puzzle arising re BT ceasing POP supportTerry Pinnell

1
Puzzle arising re BT ceasing POP support

<g48uhihpih66rt69oitqn9fmlsahrbt2v9@4ax.com>

  copy mid

https://www.rocksolidbbs.com/computers/article-flat.php?id=5351&group=alt.usenet.offline-reader.forte-agent#5351

  copy link   Newsgroups: alt.usenet.offline-reader.forte-agent
Path: i2pn2.org!rocksolid2!news.neodome.net!fu-berlin.de!uni-berlin.de!individual.net!not-for-mail
From: me@somewhere.invalid (Terry Pinnell)
Newsgroups: alt.usenet.offline-reader.forte-agent
Subject: Puzzle arising re BT ceasing POP support
Date: Thu, 05 Oct 2023 21:49:38 +0100
Lines: 17
Message-ID: <g48uhihpih66rt69oitqn9fmlsahrbt2v9@4ax.com>
Mime-Version: 1.0
Content-Type: text/plain; charset=us-ascii
Content-Transfer-Encoding: 7bit
X-Trace: individual.net VkhwlSnr4b9NNKy0oMl2UAiwWCKytPkswYYcZwIxMW3UvgOW6x
Cancel-Lock: sha1:Cg9ZqjdEDiSZjOU2yDaxTm0PcR0= sha256:0Vv97QPDvJgcj9maZhP/JAL+q5ysxY8XnrxzxxISR6k=
X-Newsreader: Forte Agent 4.2/32.1118
 by: Terry Pinnell - Thu, 5 Oct 2023 20:49 UTC

I read that BT incoming email via POP ceased on 31 Jan 2023.

https://business.forums.bt.com/t5/Email-and-hosting/What-to-do-after-POP-switch-off/td-p/88414

https://www.syn-star.co.uk/business-telecoms-voip-bt-has-switched-off-pop3-what-does-this-mean-for-businesses/#:~:text=Last%20October%20BT%20decided%20to,only%20to%20use%20BT's%20Webmail.

While that was referring to BT's own online email, should that have
affected Agent's behaviour too?

Anyone else here using Agent with a BT account? I use BT broadband but
I'm so fed up with the hassle I'm having with BT email that I'm tempted
to drop it. And stick with just my gmail account. But I used the BT
address so widely that I'm hesitating to do so.

Terry

Re: Puzzle arising re BT ceasing POP support

<19juhil22ovjreeedkbpdo5ai66ul1c838@4ax.com>

  copy mid

https://www.rocksolidbbs.com/computers/article-flat.php?id=5352&group=alt.usenet.offline-reader.forte-agent#5352

  copy link   Newsgroups: alt.usenet.offline-reader.forte-agent
Path: i2pn2.org!i2pn.org!usenet.goja.nl.eu.org!weretis.net!feeder8.news.weretis.net!newsreader4.netcologne.de!news.netcologne.de!peer02.ams1!peer.ams1.xlned.com!news.xlned.com!peer01.iad!feed-me.highwinds-media.com!news.highwinds-media.com!fx33.iad.POSTED!not-for-mail
From: -rf-nz-@-.invalid (Ralph Fox)
Newsgroups: alt.usenet.offline-reader.forte-agent
Subject: Re: Puzzle arising re BT ceasing POP support
Message-ID: <19juhil22ovjreeedkbpdo5ai66ul1c838@4ax.com>
References: <g48uhihpih66rt69oitqn9fmlsahrbt2v9@4ax.com>
User-Agent: ForteAgent/8.00.32.1272
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
X-Face: 5gSW~"1=jGDo(BXfTrgL2BnC3tUB_\d0u@mP~wA1fvK`z8I[>1jXVVZ!N6ittQ.K<5!i3l> ==jcyAk.[B>kLg8TY{+8%edZ(le:ncPt%s8Pr?]QXNXO]0RC#V_zt|%>=bt>rZ2iCI^-yl7Be(]Ep> OfyI!3Bf|e
Lines: 42
X-Complaints-To: abuse@easynews.com
Organization: Forte - www.forteinc.com
X-Complaints-Info: Please be sure to forward a copy of ALL headers otherwise we will be unable to process your complaint properly.
Date: Fri, 06 Oct 2023 13:01:32 +1300
X-Received-Bytes: 2737
 by: Ralph Fox - Fri, 6 Oct 2023 00:01 UTC

On Thu, 05 Oct 2023 21:49:38 +0100, Terry Pinnell wrote:

> I read that BT incoming email via POP ceased on 31 Jan 2023.
>
> https://business.forums.bt.com/t5/Email-and-hosting/What-to-do-after-POP-switch-off/td-p/88414
>
> https://www.syn-star.co.uk/business-telecoms-voip-bt-has-switched-off-pop3-what-does-this-mean-for-businesses/#:~:text=Last%20October%20BT%20decided%20to,only%20to%20use%20BT's%20Webmail.
>
> While that was referring to BT's own online email, should that have
> affected Agent's behaviour too?

BT still provides POP email server settings to use in programs like
Agent. Those settings still appear to work in Forté Agent, as far
as I can test without a BT login.

<https://www.bt.com/help/email/manage-email-account/manual-settings/what-are-the-settings-for-outgoing-and-incoming-bt-email-servers>

POP3 settings
–––––––––––––
Host name/Incoming Mail Server: mail.btinternet.com
The server requires a secure connection (SSL)/SSL Encryption: Enabled (check-marked)
Username: your email address including the @btinternet.com or @btopenworld.com part
Password: your btinternet or btopenworld password
Advanced Settings >> Port/Port: 995 (the default value when SSL is selected)

> Anyone else here using Agent with a BT account? I use BT broadband but
> I'm so fed up with the hassle I'm having with BT email that I'm tempted
> to drop it. And stick with just my gmail account. But I used the BT
> address so widely that I'm hesitating to do so.
>
> Terry

--
Kind regards
Ralph Fox

Spring is sprung, the grass is riz, I wonder where the birdies is.
They say the bird is on the wing — but that’s absurd; I thought the wing was on the bird.

Re: Puzzle arising re BT ceasing POP support

<uk80iitap079p59v9nsj4b5eo10mop0gio@4ax.com>

  copy mid

https://www.rocksolidbbs.com/computers/article-flat.php?id=5354&group=alt.usenet.offline-reader.forte-agent#5354

  copy link   Newsgroups: alt.usenet.offline-reader.forte-agent
Path: i2pn2.org!i2pn.org!news.nntp4.net!weretis.net!feeder8.news.weretis.net!fu-berlin.de!uni-berlin.de!individual.net!not-for-mail
From: me@somewhere.invalid (Terry Pinnell)
Newsgroups: alt.usenet.offline-reader.forte-agent
Subject: Re: Puzzle arising re BT ceasing POP support
Date: Fri, 06 Oct 2023 16:07:43 +0100
Lines: 49
Message-ID: <uk80iitap079p59v9nsj4b5eo10mop0gio@4ax.com>
References: <g48uhihpih66rt69oitqn9fmlsahrbt2v9@4ax.com> <19juhil22ovjreeedkbpdo5ai66ul1c838@4ax.com>
Mime-Version: 1.0
Content-Type: text/plain; charset=ISO-8859-1
Content-Transfer-Encoding: 8bit
X-Trace: individual.net XlxZ0WxrC0X1gChzFSBgggulzXnWPIAqv7VA4ixjjRevWsLm2V
Cancel-Lock: sha1:hFCDByEixJ1EVxE6YOuWra4ErTo= sha256:HmssQxoX922Dq9YJXc0Hl9DjIbHdEwiWro6b6NelHts=
X-Newsreader: Forte Agent 4.2/32.1118
 by: Terry Pinnell - Fri, 6 Oct 2023 15:07 UTC

Ralph Fox <-rf-nz-@-.invalid> wrote:

>On Thu, 05 Oct 2023 21:49:38 +0100, Terry Pinnell wrote:
>
>> I read that BT incoming email via POP ceased on 31 Jan 2023.
>>
>> https://business.forums.bt.com/t5/Email-and-hosting/What-to-do-after-POP-switch-off/td-p/88414
>>
>> https://www.syn-star.co.uk/business-telecoms-voip-bt-has-switched-off-pop3-what-does-this-mean-for-businesses/#:~:text=Last%20October%20BT%20decided%20to,only%20to%20use%20BT's%20Webmail.
>>
>> While that was referring to BT's own online email, should that have
>> affected Agent's behaviour too?
>
>
>BT still provides POP email server settings to use in programs like
>Agent. Those settings still appear to work in Forté Agent, as far
>as I can test without a BT login.
>
><https://www.bt.com/help/email/manage-email-account/manual-settings/what-are-the-settings-for-outgoing-and-incoming-bt-email-servers>
>
> POP3 settings
> –––––––––––––
> Host name/Incoming Mail Server: mail.btinternet.com
> The server requires a secure connection (SSL)/SSL Encryption: Enabled (check-marked)
> Username: your email address including the @btinternet.com or @btopenworld.com part
> Password: your btinternet or btopenworld password
> Advanced Settings >> Port/Port: 995 (the default value when SSL is selected)
>
>
>> Anyone else here using Agent with a BT account? I use BT broadband but
>> I'm so fed up with the hassle I'm having with BT email that I'm tempted
>> to drop it. And stick with just my gmail account. But I used the BT
>> address so widely that I'm hesitating to do so.
>>
>> Terry

Thanks Ralph.

My iPhone BT account fails with port 995; 993 works. My older iPad also
needs 993, but for the newer one it's 995.

I'm testing all four From/To options on iPhone Mail, iPad Mail and PC
Agent.

Making progress.I think the duplicate issue (only in Agent) is because I
also had an IMAP account set up on the iPad. About to repeat the test
with it disabled. What negative impact of deleting the IMAP account?

Terry

Re: Puzzle arising re BT ceasing POP support

<39j0ii5gfn22fe46n8ivdjqu0e0h40c9nn@4ax.com>

  copy mid

https://www.rocksolidbbs.com/computers/article-flat.php?id=5355&group=alt.usenet.offline-reader.forte-agent#5355

  copy link   Newsgroups: alt.usenet.offline-reader.forte-agent
Path: i2pn2.org!i2pn.org!usenet.blueworldhosting.com!diablo1.usenet.blueworldhosting.com!peer01.iad!feed-me.highwinds-media.com!news.highwinds-media.com!fx38.iad.POSTED!not-for-mail
From: -rf-nz-@-.invalid (Ralph Fox)
Newsgroups: alt.usenet.offline-reader.forte-agent
Subject: Re: Puzzle arising re BT ceasing POP support
Message-ID: <39j0ii5gfn22fe46n8ivdjqu0e0h40c9nn@4ax.com>
References: <g48uhihpih66rt69oitqn9fmlsahrbt2v9@4ax.com> <19juhil22ovjreeedkbpdo5ai66ul1c838@4ax.com> <uk80iitap079p59v9nsj4b5eo10mop0gio@4ax.com>
User-Agent: ForteAgent/8.00.32.1272
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
X-Face: 5gSW~"1=jGDo(BXfTrgL2BnC3tUB_\d0u@mP~wA1fvK`z8I[>1jXVVZ!N6ittQ.K<5!i3l> ==jcyAk.[B>kLg8TY{+8%edZ(le:ncPt%s8Pr?]QXNXO]0RC#V_zt|%>=bt>rZ2iCI^-yl7Be(]Ep> OfyI!3Bf|e
Lines: 30
X-Complaints-To: abuse@easynews.com
Organization: Forte - www.forteinc.com
X-Complaints-Info: Please be sure to forward a copy of ALL headers otherwise we will be unable to process your complaint properly.
Date: Sat, 07 Oct 2023 07:11:19 +1300
X-Received-Bytes: 1921
 by: Ralph Fox - Fri, 6 Oct 2023 18:11 UTC

On Fri, 06 Oct 2023 16:07:43 +0100, Terry Pinnell wrote:

> My iPhone BT account fails with port 995; 993 works. My older iPad also
> needs 993, but for the newer one it's 995.

Port 995 is for using POP to fetch your email (with SSL).
Port 993 is for using IMAP to fetch your email (with SSL).

In each case check which one, POP or IMAP, the app is set up to use.

Do not try using POP port 995 in an app which uses IMAP. It won’t work.
Do not try using IMAP port 993 in an app which uses POP. It won’t work.


> I'm testing all four From/To options on iPhone Mail, iPad Mail and PC
> Agent.
>
> Making progress.I think the duplicate issue (only in Agent) is because I
> also had an IMAP account set up on the iPad. About to repeat the test
> with it disabled. What negative impact of deleting the IMAP account?

I don’t know anything about your app which has the IMAP account.

--
Kind regards
Ralph Fox
🤷‍

Re: Puzzle arising re BT ceasing POP support

<bdk8iih92i2mqm8ov23j8lphmi2d9o8egu@4ax.com>

  copy mid

https://www.rocksolidbbs.com/computers/article-flat.php?id=5356&group=alt.usenet.offline-reader.forte-agent#5356

  copy link   Newsgroups: alt.usenet.offline-reader.forte-agent
Path: i2pn2.org!i2pn.org!weretis.net!feeder8.news.weretis.net!fu-berlin.de!uni-berlin.de!individual.net!not-for-mail
From: me@somewhere.invalid (Terry Pinnell)
Newsgroups: alt.usenet.offline-reader.forte-agent
Subject: Re: Puzzle arising re BT ceasing POP support
Date: Mon, 09 Oct 2023 20:19:03 +0100
Lines: 27
Message-ID: <bdk8iih92i2mqm8ov23j8lphmi2d9o8egu@4ax.com>
References: <g48uhihpih66rt69oitqn9fmlsahrbt2v9@4ax.com> <19juhil22ovjreeedkbpdo5ai66ul1c838@4ax.com> <uk80iitap079p59v9nsj4b5eo10mop0gio@4ax.com> <39j0ii5gfn22fe46n8ivdjqu0e0h40c9nn@4ax.com>
Mime-Version: 1.0
Content-Type: text/plain; charset=ISO-8859-1
Content-Transfer-Encoding: 8bit
X-Trace: individual.net I4YIc/Laujs18Yg3xY6z1wX7X9hQwrC8u/SH7s3K2p7tRRIjW1
Cancel-Lock: sha1:eSe3AzM7yYD9zQ5z2Gq5exlM7og= sha256:BLUhNMQJ2s7Mwyi3Lw47A0kGUyr5W+ntKzYYK1IRmDk=
X-Newsreader: Forte Agent 4.2/32.1118
 by: Terry Pinnell - Mon, 9 Oct 2023 19:19 UTC

Ralph Fox <-rf-nz-@-.invalid> wrote:

>On Fri, 06 Oct 2023 16:07:43 +0100, Terry Pinnell wrote:
>
>> My iPhone BT account fails with port 995; 993 works. My older iPad also
>> needs 993, but for the newer one it's 995.
>
>
>Port 995 is for using POP to fetch your email (with SSL).
>Port 993 is for using IMAP to fetch your email (with SSL).
>
>In each case check which one, POP or IMAP, the app is set up to use.
>
>Do not try using POP port 995 in an app which uses IMAP. It won’t work.
>Do not try using IMAP port 993 in an app which uses POP. It won’t work.
>
>
>> I'm testing all four From/To options on iPhone Mail, iPad Mail and PC
>> Agent.
>>
>> Making progress.I think the duplicate issue (only in Agent) is because I
>> also had an IMAP account set up on the iPad. About to repeat the test
>> with it disabled. What negative impact of deleting the IMAP account?
>
>I don’t know anything about your app which has the IMAP account.

It's iOS Mail, the built-in email app on iPhones/iPads.

Re: Puzzle arising re BT ceasing POP support

<4p0vjilf8e9f7uusvsu6pdcor46k06nlhi@4ax.com>

  copy mid

https://www.rocksolidbbs.com/computers/article-flat.php?id=5393&group=alt.usenet.offline-reader.forte-agent#5393

  copy link   Newsgroups: alt.usenet.offline-reader.forte-agent
Path: i2pn2.org!i2pn.org!eternal-september.org!feeder2.eternal-september.org!eternal-september.org!fu-berlin.de!uni-berlin.de!individual.net!not-for-mail
From: me@somewhere.invalid (Terry Pinnell)
Newsgroups: alt.usenet.offline-reader.forte-agent
Subject: Re: Puzzle arising re BT ceasing POP support
Date: Mon, 30 Oct 2023 10:40:42 +0000
Lines: 136
Message-ID: <4p0vjilf8e9f7uusvsu6pdcor46k06nlhi@4ax.com>
References: <g48uhihpih66rt69oitqn9fmlsahrbt2v9@4ax.com> <19juhil22ovjreeedkbpdo5ai66ul1c838@4ax.com> <uk80iitap079p59v9nsj4b5eo10mop0gio@4ax.com> <39j0ii5gfn22fe46n8ivdjqu0e0h40c9nn@4ax.com>
Mime-Version: 1.0
Content-Type: text/plain; charset=ISO-8859-1
Content-Transfer-Encoding: 8bit
X-Trace: individual.net dG+qKIZcwN8T++3pavmSQw/wvWXmN/C2POXns9OwIXVtP6ml3j
Cancel-Lock: sha1:9Kfv0ETCuwMozpErdwsAuPUzQ+I= sha256:DnogzgcdWj5xanPE8lHnVDCIjncMO0T2NFpCyA7dt18=
X-Newsreader: Forte Agent 4.2/32.1118
 by: Terry Pinnell - Mon, 30 Oct 2023 10:40 UTC

Ralph Fox <-rf-nz-@-.invalid> wrote:

>On Fri, 06 Oct 2023 16:07:43 +0100, Terry Pinnell wrote:
>
>> My iPhone BT account fails with port 995; 993 works. My older iPad also
>> needs 993, but for the newer one it's 995.
>
>
>Port 995 is for using POP to fetch your email (with SSL).
>Port 993 is for using IMAP to fetch your email (with SSL).
>
>In each case check which one, POP or IMAP, the app is set up to use.
>
>Do not try using POP port 995 in an app which uses IMAP. It won’t work.
>Do not try using IMAP port 993 in an app which uses POP. It won’t work.
>
>
>> I'm testing all four From/To options on iPhone Mail, iPad Mail and PC
>> Agent.
>>
>> Making progress.I think the duplicate issue (only in Agent) is because I
>> also had an IMAP account set up on the iPad. About to repeat the test
>> with it disabled. What negative impact of deleting the IMAP account?
>
>I don’t know anything about your app which has the IMAP account.

I deleted that IMAP account but no change. Still getting duplicates.
Just sent one to myself. Do the two respective headers help identify the
cause please?

MIME-Version: 1.0
Date: Mon, 30 Oct 2023 10:01:28 +0000
Message-ID:
<CAEU3o8458DBHKx=nEnfjbNnJmXTZXmi6tC5+454ukebfcfdx5A@mail.gmail.com>
Subject: From g to b on iPhone
From: Terry Pinnell <(mygmail address)>
To: Terry-BT-email <(my BT mail address)>
Content-Type: multipart/alternative;
boundary="0000000000002a685c0608ec1f1e"
X-Agent-Received: from Gmail (POP) (pop.gmail.com); Mon, 30 Oct 2023
10:01:45 +0000
X-Agent-Junk-Probability: 0

====================

Return-Path: <(mygmail address)>
Received: from re-prd-rgin-014.btmx-prd.synchronoss.net ([10.2.54.22])
by re-prd-fep-014.mx.internal with ESMTP
id
<20231030100139.PYSN12241.re-prd-fep-014.mx.internal@re-prd-rgin-014.btmx-prd.synchronoss.net>
for <(my BT mail address)>; Mon, 30 Oct 2023 10:01:39 +0000
Authentication-Results: btinternet.com;
dmarc=pass header.from=gmail.com;
dkim=fail;
spf=none smtp.helo=mail-lf1-f47.google.com;
spf=pass smtp.mailfrom=gmail.com;
bimi=skipped
X-OWM-SPF-MAILFROM: Pass
X-OWM-SPF: 0
Received-SPF: none (re-prd-rgin-014.btmx-prd.synchronoss.net: domain
mail-lf1-f47.google.com does not designate permitted sender hosts)
identity=helo; receiver=re-prd-rgin-014.btmx-prd.synchronoss.net;
client-ip=209.85.167.47; helo=mail-lf1-f47.google.com;
Received-SPF: pass (re-prd-rgin-014.btmx-prd.synchronoss.net: domain
gmail.com
designates 209.85.167.47 as permitted sender) identity=mailfrom;
receiver=re-prd-rgin-014.btmx-prd.synchronoss.net;
client-ip=209.85.167.47;
envelope-from=(mygmail address); helo=mail-lf1-f47.google.com;
X-Originating-IP: [209.85.167.47]
X-OWM-Source-IP: 209.85.167.47 (US)
X-OWM-Env-Sender: (mygmail address)
X-SNCR-Rigid: 647E765D1820188E
X-OWM-DMARC: spf 0 dkim 7
X-OWM-DKIM: 2
X-VadeSecure-score: verdict=clean score=50/320, class=clean
X-SNCR-VADESECURE: CLEAN
X-RazorGate-Vade:
gggruggvucftvghtrhhoucdtuddrgedvkedruddttddgtdelucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuueftkffvkffujffvgffngfevqffonecuuegrihhlohhuthemuceftddunecugfhmphhthicusghougihucdlhedtmdenucfjughrpegghfffkffuvfgtsegrtderredttdejnecuhfhrohhmpefvvghrrhihucfrihhnnhgvlhhluceothgvrhhrhihpihhnghhmsehgmhgrihhlrdgtohhmqeenucggtffrrghtthgvrhhnpeeitddtheevudeuteeijeeuvdeuteetheetgeehgfejgefftdfhleeludevieetieenucfkphepvddtledrkeehrdduieejrdegjeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhephhgvlhhopehmrghilhdqlhhfuddqfhegjedrghhoohhglhgvrdgtohhmpdhinhgvthepvddtledrkeehrdduieejrdegjedpmhgrihhlfhhrohhmpehtvghrrhihphhinhhgmhesghhmrghilhdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehtrdhpihhnnhgvlhhlsegsthhinhhtvghrnhgvthdrtghomhdprhgvvhfkrfepmhgrihhlqdhlfhduqdhfgeejrdhgohhoghhlvgdrtghomhdpshhpfhepphgrshhspdgukhhimhepfhgrihhlpdhgvghokffrpegfufdpoffvtefjohhstheprhgvqdhprhguqdhrghhinhdqtdduge
X-RazorGate-Vade-Verdict: clean 50
X-RazorGate-Vade-Classification: clean
Received: from mail-lf1-f47.google.com (209.85.167.47) by
re-prd-rgin-014.btmx-prd.synchronoss.net (5.8.818)
id 647E765D1820188E for (my BT mail address); Mon, 30 Oct 2023
10:01:39 +0000
Received: by mail-lf1-f47.google.com with SMTP id
2adb3069b0e04-507c91582fdso6134467e87.2
for <(my BT mail address)>; Mon, 30 Oct 2023 03:01:39 -0700
(PDT)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=gmail.com; s=20230601; t=1698660099; x=1699264899;
darn=btinternet.com;
h=to:subject:message-id:date:from:mime-version:from:to:cc:subject
:date:message-id:reply-to;
bh=MJgBuCpOBSnwycoDbV2pkVjPi7Yc7pe/fwjnSg3UY1k=;
b=W/BxzXVw1mJc9ja6V9H/zq3XVBHTHGurnavr1RIKJ/7ypqxcQoexvsv8cwJmNubArr
nBQ7uUdAH0/FvbxbC+NYGfiimXRFCJoEOCNF/Uzd8412VnBLXgQzdDyHloLteWgJElEq
SxjcWbwbSNBRmo2As9Gz1XgTAg+LzKFB9BRvEgVvl/mape7WRh0JLSQiXxxgHCIu5EZo
7B1C00WoULV/q/A07LPM5fgkEChzd6F1eWHAiALTKd8QB51Oa8GxEDnpb+0ONSWYmx8z
xREldzaT6IqXfXKu5zzAC3ZpTbpI2agUR5D1VabuWTpD+TvraKDr9ksrERlPtWzPnyDN
IvDw==
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=1e100.net; s=20230601; t=1698660099; x=1699264899;
h=to:subject:message-id:date:from:mime-version:x-gm-message-state
:from:to:cc:subject:date:message-id:reply-to;
bh=MJgBuCpOBSnwycoDbV2pkVjPi7Yc7pe/fwjnSg3UY1k=;
b=ZcMurd8iYEkNtrXwdpCtC5HeoQgjjOm/MsjWbxHCN/3975Jfip3eYcVtvXUApJHE0R
1hIpUEQnclw/qAdBqq7OvHnZZD3U48hodz2Yzsj/J6CoipmsmbD4+C6h5S/x5QkzXbkC
kmfvtAfLe1FDGxsk6YzyQxPrfPA80DFutgQ30NRUA+PMzIrJbPP1HG1O9W9rEmneYM2j
EiJ6BOKTNZaeKSBSNwdjqwhi+mw4Vd9esiBIMLiQZ+h53L/qkEa2jmd3H07S8GVYV0Jd
IPDhF8mWyVUTjK0L7plBzapnx7ZzvgJg6pTApJjCgIdsLZjhnNV7Zj6D8s2R1+d+c5E5
FXzg==
X-Gm-Message-State:
AOJu0YxoM2X7Y3mJEtXI3bmBPpbCm23HrwjGZSefXT6AKXdnSqKnfJ+0
loV3VLAl5XkuVGlITtmigqj1PO6jFeG31qfGMP1yNC2+024=
X-Google-Smtp-Source:
AGHT+IETiggGaDcr1amq1L9EAv286pKA9CFP0jrkOITzmxFBJHQqqF7a0hFTetDG37iUJxQGEOH+8UEpBdzfnkcNR/w=
X-Received: by 2002:ac2:5183:0:b0:509:1301:8470 with SMTP id
u3-20020ac25183000000b0050913018470mr3030416lfi.45.1698660098938; Mon,
30 Oct
2023 03:01:38 -0700 (PDT)
MIME-Version: 1.0
From: Terry Pinnell <(mygmail address)>
Date: Mon, 30 Oct 2023 10:01:28 +0000
Message-ID:
<CAEU3o8458DBHKx=nEnfjbNnJmXTZXmi6tC5+454ukebfcfdx5A@mail.gmail.com>
Subject: From g to b on iPhone
To: Terry-BT-email <(my BT mail address)>
Content-Type: multipart/alternative;
boundary="000000000000caa0730608ec1fe2"
X-Agent-Received: from BT (POP) (mail.btinternet.com); Mon, 30 Oct 2023
10:01:45 +0000
X-Agent-Junk-Probability: 0

Terry

Re: Puzzle arising re BT ceasing POP support

<jp54kil6bbk53bebidr8j0enje2a7stlp7@4ax.com>

  copy mid

https://www.rocksolidbbs.com/computers/article-flat.php?id=5395&group=alt.usenet.offline-reader.forte-agent#5395

  copy link   Newsgroups: alt.usenet.offline-reader.forte-agent
Path: i2pn2.org!i2pn.org!usenet.goja.nl.eu.org!3.eu.feeder.erje.net!feeder.erje.net!newsreader4.netcologne.de!news.netcologne.de!peer02.ams1!peer.ams1.xlned.com!news.xlned.com!peer01.iad!feed-me.highwinds-media.com!news.highwinds-media.com!fx10.iad.POSTED!not-for-mail
From: -rf-nz-@-.invalid (Ralph Fox)
Newsgroups: alt.usenet.offline-reader.forte-agent
Subject: Re: Puzzle arising re BT ceasing POP support
Message-ID: <jp54kil6bbk53bebidr8j0enje2a7stlp7@4ax.com>
References: <g48uhihpih66rt69oitqn9fmlsahrbt2v9@4ax.com> <19juhil22ovjreeedkbpdo5ai66ul1c838@4ax.com> <uk80iitap079p59v9nsj4b5eo10mop0gio@4ax.com> <39j0ii5gfn22fe46n8ivdjqu0e0h40c9nn@4ax.com> <4p0vjilf8e9f7uusvsu6pdcor46k06nlhi@4ax.com>
User-Agent: ForteAgent/8.00.32.1272
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
X-Face: 5gSW~"1=jGDo(BXfTrgL2BnC3tUB_\d0u@mP~wA1fvK`z8I[>1jXVVZ!N6ittQ.K<5!i3l> ==jcyAk.[B>kLg8TY{+8%edZ(le:ncPt%s8Pr?]QXNXO]0RC#V_zt|%>=bt>rZ2iCI^-yl7Be(]Ep> OfyI!3Bf|e
Lines: 177
X-Complaints-To: abuse@easynews.com
Organization: Forte - www.forteinc.com
X-Complaints-Info: Please be sure to forward a copy of ALL headers otherwise we will be unable to process your complaint properly.
Date: Wed, 01 Nov 2023 22:15:41 +1300
X-Received-Bytes: 10995
 by: Ralph Fox - Wed, 1 Nov 2023 09:15 UTC

On Mon, 30 Oct 2023 10:40:42 +0000, Terry Pinnell wrote:

> I deleted that IMAP account but no change. Still getting duplicates.
> Just sent one to myself. Do the two respective headers help identify the
> cause please?

Look at these...

A. First Look at the "X-Agent-Received:" header line, which is added
by Agent when downloading the email.
1) The first header below was downloaded from Gmail (not from BT).
~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
X-Agent-Received: from Gmail (POP) (pop.gmail.com); Mon, 30 Oct 2023 10:01:45 +0000
~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
2) The second header below was downloaded from BT.
~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
X-Agent-Received: from BT (POP) (mail.btinternet.com); Mon, 30 Oct 2023 10:01:45 +0000
~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

For some reason Gmail is putting a copy of the sent email into
your Gmail POP3 Inbox. This is where Agent gets the first copy
below from.
* Perhaps your iOS mail app is configured to Bcc a copy of the
email to your Gmail account.
* If it is not your own iOS mail app settings, it might be your
Gmail account settings. However, I am not aware of a Gmail
account setting which would do this.

Ultimately it would be settings you control which are putting a
copy of the email into your Gmail inbox in addition to sending
the email to your BT inbox. The headers don't tell me which
settings are doing this, only that this is what is going on.

B. Now look at all the "Received:" header lines in each header.
These, read from bottom to top, show the email hopping from
server to server on its way to the destination.
1) The first header below has no "Received:" header lines.
This means it has not gone anywhere. You posted it from
your Gmail account, and this copy was still in your Gmail
account from where Agent downloaded it.
2) The second header below has these three "Received:" header
lines:
~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
Received: from re-prd-rgin-014.btmx-prd.synchronoss.net ([10.2.54.22])
by re-prd-fep-014.mx.internal with ESMTP
id <20231030100139.PYSN12241.re-prd-fep-014.mx.internal@re-prd-rgin-014.btmx-prd.synchronoss.net>
for <(my BT mail address)>; Mon, 30 Oct 2023 10:01:39 +0000
Received: from mail-lf1-f47.google.com (209.85.167.47) by re-prd-rgin-014.btmx-prd.synchronoss.net (5.8.818)
id 647E765D1820188E for (my BT mail address); Mon, 30 Oct 2023 10:01:39 +0000
Received: by mail-lf1-f47.google.com with SMTP id 2adb3069b0e04-507c91582fdso6134467e87.2
for <(my BT mail address)>; Mon, 30 Oct 2023 03:01:39 -0700 (PDT)
~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

These header lines must be read from bottom to top.
* The bottom "Received:" header is your email hopping
from one Google server to another, from where it will
then be sent off to BT.
* The middle "Received:" header is your email hopping
from a Google server to a BT mail exchange (mx) server.
* The top "Received:" header is your email hopping from
the BT mail exchange (mx) server to the server where
your BT inbox lives.

______________________________________________________________________

> MIME-Version: 1.0
> Date: Mon, 30 Oct 2023 10:01:28 +0000
> Message-ID:
> <CAEU3o8458DBHKx=nEnfjbNnJmXTZXmi6tC5+454ukebfcfdx5A@mail.gmail.com>
> Subject: From g to b on iPhone
> From: Terry Pinnell <(mygmail address)>
> To: Terry-BT-email <(my BT mail address)>
> Content-Type: multipart/alternative;
> boundary="0000000000002a685c0608ec1f1e"
> X-Agent-Received: from Gmail (POP) (pop.gmail.com); Mon, 30 Oct 2023
> 10:01:45 +0000
> X-Agent-Junk-Probability: 0
>
> ====================
>
> Return-Path: <(mygmail address)>
> Received: from re-prd-rgin-014.btmx-prd.synchronoss.net ([10.2.54.22])
> by re-prd-fep-014.mx.internal with ESMTP
> id
> <20231030100139.PYSN12241.re-prd-fep-014.mx.internal@re-prd-rgin-014.btmx-prd.synchronoss.net>
> for <(my BT mail address)>; Mon, 30 Oct 2023 10:01:39 +0000
> Authentication-Results: btinternet.com;
> dmarc=pass header.from=gmail.com;
> dkim=fail;
> spf=none smtp.helo=mail-lf1-f47.google.com;
> spf=pass smtp.mailfrom=gmail.com;
> bimi=skipped
> X-OWM-SPF-MAILFROM: Pass
> X-OWM-SPF: 0
> Received-SPF: none (re-prd-rgin-014.btmx-prd.synchronoss.net: domain
> mail-lf1-f47.google.com does not designate permitted sender hosts)
> identity=helo; receiver=re-prd-rgin-014.btmx-prd.synchronoss.net;
> client-ip=209.85.167.47; helo=mail-lf1-f47.google.com;
> Received-SPF: pass (re-prd-rgin-014.btmx-prd.synchronoss.net: domain
> gmail.com
> designates 209.85.167.47 as permitted sender) identity=mailfrom;
> receiver=re-prd-rgin-014.btmx-prd.synchronoss.net;
> client-ip=209.85.167.47;
> envelope-from=(mygmail address); helo=mail-lf1-f47.google.com;
> X-Originating-IP: [209.85.167.47]
> X-OWM-Source-IP: 209.85.167.47 (US)
> X-OWM-Env-Sender: (mygmail address)
> X-SNCR-Rigid: 647E765D1820188E
> X-OWM-DMARC: spf 0 dkim 7
> X-OWM-DKIM: 2
> X-VadeSecure-score: verdict=clean score=50/320, class=clean
> X-SNCR-VADESECURE: CLEAN
> X-RazorGate-Vade:
> gggruggvucftvghtrhhoucdtuddrgedvkedruddttddgtdelucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuueftkffvkffujffvgffngfevqffonecuuegrihhlohhuthemuceftddunecugfhmphhthicusghougihucdlhedtmdenucfjughrpegghfffkffuvfgtsegrtderredttdejnecuhfhrohhmpefvvghrrhihucfrihhnnhgvlhhluceothgvrhhrhihpihhnghhmsehgmhgrihhlrdgtohhmqeenucggtffrrghtthgvrhhnpeeitddtheevudeuteeijeeuvdeuteetheetgeehgfejgefftdfhleeludevieetieenucfkphepvddtledrkeehrdduieejrdegjeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhephhgvlhhopehmrghilhdqlhhfuddqfhegjedrghhoohhglhgvrdgtohhmpdhinhgvthepvddtledrkeehrdduieejrdegjedpmhgrihhlfhhrohhmpehtvghrrhihphhinhhgmhesghhmrghilhdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehtrdhpihhnnhgvlhhlsegsthhinhhtvghrnhgvthdrtghomhdprhgvvhfkrfepmhgrihhlqdhlfhduqdhfgeejrdhgohhoghhlvgdrtghomhdpshhpfhepphgrshhspdgukhhimhepfhgrihhlpdhgvghokffrpegfufdpoffvtefjohhstheprhgvqdhprhguqdhrghhinhdqtdduge
> X-RazorGate-Vade-Verdict: clean 50
> X-RazorGate-Vade-Classification: clean
> Received: from mail-lf1-f47.google.com (209.85.167.47) by
> re-prd-rgin-014.btmx-prd.synchronoss.net (5.8.818)
> id 647E765D1820188E for (my BT mail address); Mon, 30 Oct 2023
> 10:01:39 +0000
> Received: by mail-lf1-f47.google.com with SMTP id
> 2adb3069b0e04-507c91582fdso6134467e87.2
> for <(my BT mail address)>; Mon, 30 Oct 2023 03:01:39 -0700
> (PDT)
> DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
> d=gmail.com; s=20230601; t=1698660099; x=1699264899;
> darn=btinternet.com;
> h=to:subject:message-id:date:from:mime-version:from:to:cc:subject
> :date:message-id:reply-to;
> bh=MJgBuCpOBSnwycoDbV2pkVjPi7Yc7pe/fwjnSg3UY1k=;
> b=W/BxzXVw1mJc9ja6V9H/zq3XVBHTHGurnavr1RIKJ/7ypqxcQoexvsv8cwJmNubArr
> nBQ7uUdAH0/FvbxbC+NYGfiimXRFCJoEOCNF/Uzd8412VnBLXgQzdDyHloLteWgJElEq
> SxjcWbwbSNBRmo2As9Gz1XgTAg+LzKFB9BRvEgVvl/mape7WRh0JLSQiXxxgHCIu5EZo
> 7B1C00WoULV/q/A07LPM5fgkEChzd6F1eWHAiALTKd8QB51Oa8GxEDnpb+0ONSWYmx8z
> xREldzaT6IqXfXKu5zzAC3ZpTbpI2agUR5D1VabuWTpD+TvraKDr9ksrERlPtWzPnyDN
> IvDw==
> X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
> d=1e100.net; s=20230601; t=1698660099; x=1699264899;
> h=to:subject:message-id:date:from:mime-version:x-gm-message-state
> :from:to:cc:subject:date:message-id:reply-to;
> bh=MJgBuCpOBSnwycoDbV2pkVjPi7Yc7pe/fwjnSg3UY1k=;
> b=ZcMurd8iYEkNtrXwdpCtC5HeoQgjjOm/MsjWbxHCN/3975Jfip3eYcVtvXUApJHE0R
> 1hIpUEQnclw/qAdBqq7OvHnZZD3U48hodz2Yzsj/J6CoipmsmbD4+C6h5S/x5QkzXbkC
> kmfvtAfLe1FDGxsk6YzyQxPrfPA80DFutgQ30NRUA+PMzIrJbPP1HG1O9W9rEmneYM2j
> EiJ6BOKTNZaeKSBSNwdjqwhi+mw4Vd9esiBIMLiQZ+h53L/qkEa2jmd3H07S8GVYV0Jd
> IPDhF8mWyVUTjK0L7plBzapnx7ZzvgJg6pTApJjCgIdsLZjhnNV7Zj6D8s2R1+d+c5E5
> FXzg==
> X-Gm-Message-State:
> AOJu0YxoM2X7Y3mJEtXI3bmBPpbCm23HrwjGZSefXT6AKXdnSqKnfJ+0
> loV3VLAl5XkuVGlITtmigqj1PO6jFeG31qfGMP1yNC2+024=
> X-Google-Smtp-Source:
> AGHT+IETiggGaDcr1amq1L9EAv286pKA9CFP0jrkOITzmxFBJHQqqF7a0hFTetDG37iUJxQGEOH+8UEpBdzfnkcNR/w=
> X-Received: by 2002:ac2:5183:0:b0:509:1301:8470 with SMTP id
> u3-20020ac25183000000b0050913018470mr3030416lfi.45.1698660098938; Mon,
> 30 Oct
> 2023 03:01:38 -0700 (PDT)
> MIME-Version: 1.0
> From: Terry Pinnell <(mygmail address)>
> Date: Mon, 30 Oct 2023 10:01:28 +0000
> Message-ID:
> <CAEU3o8458DBHKx=nEnfjbNnJmXTZXmi6tC5+454ukebfcfdx5A@mail.gmail.com>
> Subject: From g to b on iPhone
> To: Terry-BT-email <(my BT mail address)>
> Content-Type: multipart/alternative;
> boundary="000000000000caa0730608ec1fe2"
> X-Agent-Received: from BT (POP) (mail.btinternet.com); Mon, 30 Oct 2023
> 10:01:45 +0000
> X-Agent-Junk-Probability: 0


Click here to read the complete article
Re: Puzzle arising re BT ceasing POP support

<9kr4kilsgjn2l37fn6b7gpbm6jk91pi164@4ax.com>

  copy mid

https://www.rocksolidbbs.com/computers/article-flat.php?id=5396&group=alt.usenet.offline-reader.forte-agent#5396

  copy link   Newsgroups: alt.usenet.offline-reader.forte-agent
Path: i2pn2.org!i2pn.org!eternal-september.org!feeder2.eternal-september.org!news.eternal-september.org!.POSTED!not-for-mail
From: jock@soccer.com (Nobody)
Newsgroups: alt.usenet.offline-reader.forte-agent
Subject: Re: Puzzle arising re BT ceasing POP support
Date: Wed, 01 Nov 2023 08:29:39 -0700
Organization: A noiseless patient Spider
Lines: 27
Message-ID: <9kr4kilsgjn2l37fn6b7gpbm6jk91pi164@4ax.com>
References: <g48uhihpih66rt69oitqn9fmlsahrbt2v9@4ax.com> <19juhil22ovjreeedkbpdo5ai66ul1c838@4ax.com> <uk80iitap079p59v9nsj4b5eo10mop0gio@4ax.com> <39j0ii5gfn22fe46n8ivdjqu0e0h40c9nn@4ax.com> <4p0vjilf8e9f7uusvsu6pdcor46k06nlhi@4ax.com> <jp54kil6bbk53bebidr8j0enje2a7stlp7@4ax.com>
MIME-Version: 1.0
Content-Type: text/plain; charset=us-ascii
Content-Transfer-Encoding: 7bit
Injection-Info: dont-email.me; posting-host="f367befc6f6480ff7ae5a70ede0e9605";
logging-data="1766969"; mail-complaints-to="abuse@eternal-september.org"; posting-account="U2FsdGVkX18CiTv0S8ncI+umLd6KO/xZ"
User-Agent: ForteAgent/8.00.32.1272
Cancel-Lock: sha1:4oLpbicwkmMwTh+HXBWsNXR0NTY=
 by: Nobody - Wed, 1 Nov 2023 15:29 UTC

On Wed, 01 Nov 2023 22:15:41 +1300, Ralph Fox <-rf-nz-@-.invalid>
wrote:

>On Mon, 30 Oct 2023 10:40:42 +0000, Terry Pinnell wrote:
>
>> I deleted that IMAP account but no change. Still getting duplicates.
>> Just sent one to myself. Do the two respective headers help identify the
>> cause please?
>
>Look at these...
>
> A. First Look at the "X-Agent-Received:" header line, which is added
> by Agent when downloading the email.
> 1) The first header below was downloaded from Gmail (not from BT).
> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
> X-Agent-Received: from Gmail (POP) (pop.gmail.com); Mon, 30 Oct 2023 10:01:45 +0000
> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
> 2) The second header below was downloaded from BT.
> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
> X-Agent-Received: from BT (POP) (mail.btinternet.com); Mon, 30 Oct 2023 10:01:45 +0000
> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>
> For some reason Gmail is putting a copy of the sent email into
> your Gmail POP3 Inbox.

Probably because the OP told <gmail> via a login through browser
that's what they wanted?

Re: Puzzle arising re BT ceasing POP support

<q645ki1g1bjkp0t48ps42p3bq2aink1b6v@4ax.com>

  copy mid

https://www.rocksolidbbs.com/computers/article-flat.php?id=5397&group=alt.usenet.offline-reader.forte-agent#5397

  copy link   Newsgroups: alt.usenet.offline-reader.forte-agent
Path: i2pn2.org!i2pn.org!usenet.goja.nl.eu.org!3.eu.feeder.erje.net!2.eu.feeder.erje.net!feeder.erje.net!fu-berlin.de!uni-berlin.de!individual.net!not-for-mail
From: me@somewhere.invalid (Terry Pinnell)
Newsgroups: alt.usenet.offline-reader.forte-agent
Subject: Re: Puzzle arising re BT ceasing POP support
Date: Wed, 01 Nov 2023 18:03:13 +0000
Lines: 33
Message-ID: <q645ki1g1bjkp0t48ps42p3bq2aink1b6v@4ax.com>
References: <g48uhihpih66rt69oitqn9fmlsahrbt2v9@4ax.com> <19juhil22ovjreeedkbpdo5ai66ul1c838@4ax.com> <uk80iitap079p59v9nsj4b5eo10mop0gio@4ax.com> <39j0ii5gfn22fe46n8ivdjqu0e0h40c9nn@4ax.com> <4p0vjilf8e9f7uusvsu6pdcor46k06nlhi@4ax.com> <jp54kil6bbk53bebidr8j0enje2a7stlp7@4ax.com> <9kr4kilsgjn2l37fn6b7gpbm6jk91pi164@4ax.com>
Mime-Version: 1.0
Content-Type: text/plain; charset=us-ascii
Content-Transfer-Encoding: 7bit
X-Trace: individual.net 8zaETYQpTNb6RQDXjTx5XQ321U62fTsrc7KsMEZrPj0sMKNGKq
Cancel-Lock: sha1:XRPA8DsfbyJ06KnCPfbEK5WZhDg= sha256:dNsZhPavUX04kQECwN3ecfvA+SSDEesSv6dBsx1B/7s=
X-Newsreader: Forte Agent 4.2/32.1118
 by: Terry Pinnell - Wed, 1 Nov 2023 18:03 UTC

Nobody <jock@soccer.com> wrote:

>On Wed, 01 Nov 2023 22:15:41 +1300, Ralph Fox <-rf-nz-@-.invalid>
>wrote:
>
>>On Mon, 30 Oct 2023 10:40:42 +0000, Terry Pinnell wrote:
>>
>>> I deleted that IMAP account but no change. Still getting duplicates.
>>> Just sent one to myself. Do the two respective headers help identify the
>>> cause please?
>>
>>Look at these...
>>
>> A. First Look at the "X-Agent-Received:" header line, which is added
>> by Agent when downloading the email.
>> 1) The first header below was downloaded from Gmail (not from BT).
>> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>> X-Agent-Received: from Gmail (POP) (pop.gmail.com); Mon, 30 Oct 2023 10:01:45 +0000
>> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>> 2) The second header below was downloaded from BT.
>> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>> X-Agent-Received: from BT (POP) (mail.btinternet.com); Mon, 30 Oct 2023 10:01:45 +0000
>> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>>
>> For some reason Gmail is putting a copy of the sent email into
>> your Gmail POP3 Inbox.
>
>Probably because the OP told <gmail> via a login through browser
>that's what they wanted?

Assuming you're a gmail user can you please tell me how to navigate to
that setting please? I'm not aware of making any attempt to get Gmail to
do that.

Re: Puzzle arising re BT ceasing POP support

<un45kihip0n8c169nb5ecudo30h18crlbn@4ax.com>

  copy mid

https://www.rocksolidbbs.com/computers/article-flat.php?id=5398&group=alt.usenet.offline-reader.forte-agent#5398

  copy link   Newsgroups: alt.usenet.offline-reader.forte-agent
Path: i2pn2.org!i2pn.org!weretis.net!feeder8.news.weretis.net!fu-berlin.de!uni-berlin.de!individual.net!not-for-mail
From: me@somewhere.invalid (Terry Pinnell)
Newsgroups: alt.usenet.offline-reader.forte-agent
Subject: Re: Puzzle arising re BT ceasing POP support
Date: Wed, 01 Nov 2023 18:07:42 +0000
Lines: 182
Message-ID: <un45kihip0n8c169nb5ecudo30h18crlbn@4ax.com>
References: <g48uhihpih66rt69oitqn9fmlsahrbt2v9@4ax.com> <19juhil22ovjreeedkbpdo5ai66ul1c838@4ax.com> <uk80iitap079p59v9nsj4b5eo10mop0gio@4ax.com> <39j0ii5gfn22fe46n8ivdjqu0e0h40c9nn@4ax.com> <4p0vjilf8e9f7uusvsu6pdcor46k06nlhi@4ax.com> <jp54kil6bbk53bebidr8j0enje2a7stlp7@4ax.com>
Mime-Version: 1.0
Content-Type: text/plain; charset=us-ascii
Content-Transfer-Encoding: 7bit
X-Trace: individual.net b4pgPg8+Hu9l40tyqHHG0Q3Fsqd1ONNdsP/p96+UKylNcIJqlu
Cancel-Lock: sha1:VXT9IEo7XJ0Lr2KAvVqeCLjMgNc= sha256:BYhhXQnX5GfQDK4S8DZoADYlx9TYgyn+Fs0wCtt41uU=
X-Newsreader: Forte Agent 4.2/32.1118
 by: Terry Pinnell - Wed, 1 Nov 2023 18:07 UTC

Ralph Fox <-rf-nz-@-.invalid> wrote:

>On Mon, 30 Oct 2023 10:40:42 +0000, Terry Pinnell wrote:
>
>> I deleted that IMAP account but no change. Still getting duplicates.
>> Just sent one to myself. Do the two respective headers help identify the
>> cause please?
>
>Look at these...
>
> A. First Look at the "X-Agent-Received:" header line, which is added
> by Agent when downloading the email.
> 1) The first header below was downloaded from Gmail (not from BT).
> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
> X-Agent-Received: from Gmail (POP) (pop.gmail.com); Mon, 30 Oct 2023 10:01:45 +0000
> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
> 2) The second header below was downloaded from BT.
> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
> X-Agent-Received: from BT (POP) (mail.btinternet.com); Mon, 30 Oct 2023 10:01:45 +0000
> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>
> For some reason Gmail is putting a copy of the sent email into
> your Gmail POP3 Inbox. This is where Agent gets the first copy
> below from.
> * Perhaps your iOS mail app is configured to Bcc a copy of the
> email to your Gmail account.
> * If it is not your own iOS mail app settings, it might be your
> Gmail account settings. However, I am not aware of a Gmail
> account setting which would do this.
>
> Ultimately it would be settings you control which are putting a
> copy of the email into your Gmail inbox in addition to sending
> the email to your BT inbox. The headers don't tell me which
> settings are doing this, only that this is what is going on.
>
Thanks Ralph, I'm sure you're right, but so far I haven't discovered the
relevant setting.

>
> B. Now look at all the "Received:" header lines in each header.
> These, read from bottom to top, show the email hopping from
> server to server on its way to the destination.
> 1) The first header below has no "Received:" header lines.
> This means it has not gone anywhere. You posted it from
> your Gmail account, and this copy was still in your Gmail
> account from where Agent downloaded it.
> 2) The second header below has these three "Received:" header
> lines:
> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
> Received: from re-prd-rgin-014.btmx-prd.synchronoss.net ([10.2.54.22])
> by re-prd-fep-014.mx.internal with ESMTP
> id <20231030100139.PYSN12241.re-prd-fep-014.mx.internal@re-prd-rgin-014.btmx-prd.synchronoss.net>
> for <(my BT mail address)>; Mon, 30 Oct 2023 10:01:39 +0000
> Received: from mail-lf1-f47.google.com (209.85.167.47) by re-prd-rgin-014.btmx-prd.synchronoss.net (5.8.818)
> id 647E765D1820188E for (my BT mail address); Mon, 30 Oct 2023 10:01:39 +0000
> Received: by mail-lf1-f47.google.com with SMTP id 2adb3069b0e04-507c91582fdso6134467e87.2
> for <(my BT mail address)>; Mon, 30 Oct 2023 03:01:39 -0700 (PDT)
> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>
> These header lines must be read from bottom to top.
> * The bottom "Received:" header is your email hopping
> from one Google server to another, from where it will
> then be sent off to BT.
> * The middle "Received:" header is your email hopping
> from a Google server to a BT mail exchange (mx) server.
> * The top "Received:" header is your email hopping from
> the BT mail exchange (mx) server to the server where
> your BT inbox lives.
>
>______________________________________________________________________
>
>> MIME-Version: 1.0
>> Date: Mon, 30 Oct 2023 10:01:28 +0000
>> Message-ID:
>> <CAEU3o8458DBHKx=nEnfjbNnJmXTZXmi6tC5+454ukebfcfdx5A@mail.gmail.com>
>> Subject: From g to b on iPhone
>> From: Terry Pinnell <(mygmail address)>
>> To: Terry-BT-email <(my BT mail address)>
>> Content-Type: multipart/alternative;
>> boundary="0000000000002a685c0608ec1f1e"
>> X-Agent-Received: from Gmail (POP) (pop.gmail.com); Mon, 30 Oct 2023
>> 10:01:45 +0000
>> X-Agent-Junk-Probability: 0
>>
>> ====================
>>
>> Return-Path: <(mygmail address)>
>> Received: from re-prd-rgin-014.btmx-prd.synchronoss.net ([10.2.54.22])
>> by re-prd-fep-014.mx.internal with ESMTP
>> id
>> <20231030100139.PYSN12241.re-prd-fep-014.mx.internal@re-prd-rgin-014.btmx-prd.synchronoss.net>
>> for <(my BT mail address)>; Mon, 30 Oct 2023 10:01:39 +0000
>> Authentication-Results: btinternet.com;
>> dmarc=pass header.from=gmail.com;
>> dkim=fail;
>> spf=none smtp.helo=mail-lf1-f47.google.com;
>> spf=pass smtp.mailfrom=gmail.com;
>> bimi=skipped
>> X-OWM-SPF-MAILFROM: Pass
>> X-OWM-SPF: 0
>> Received-SPF: none (re-prd-rgin-014.btmx-prd.synchronoss.net: domain
>> mail-lf1-f47.google.com does not designate permitted sender hosts)
>> identity=helo; receiver=re-prd-rgin-014.btmx-prd.synchronoss.net;
>> client-ip=209.85.167.47; helo=mail-lf1-f47.google.com;
>> Received-SPF: pass (re-prd-rgin-014.btmx-prd.synchronoss.net: domain
>> gmail.com
>> designates 209.85.167.47 as permitted sender) identity=mailfrom;
>> receiver=re-prd-rgin-014.btmx-prd.synchronoss.net;
>> client-ip=209.85.167.47;
>> envelope-from=(mygmail address); helo=mail-lf1-f47.google.com;
>> X-Originating-IP: [209.85.167.47]
>> X-OWM-Source-IP: 209.85.167.47 (US)
>> X-OWM-Env-Sender: (mygmail address)
>> X-SNCR-Rigid: 647E765D1820188E
>> X-OWM-DMARC: spf 0 dkim 7
>> X-OWM-DKIM: 2
>> X-VadeSecure-score: verdict=clean score=50/320, class=clean
>> X-SNCR-VADESECURE: CLEAN
>> X-RazorGate-Vade:
>> gggruggvucftvghtrhhoucdtuddrgedvkedruddttddgtdelucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuueftkffvkffujffvgffngfevqffonecuuegrihhlohhuthemuceftddunecugfhmphhthicusghougihucdlhedtmdenucfjughrpegghfffkffuvfgtsegrtderredttdejnecuhfhrohhmpefvvghrrhihucfrihhnnhgvlhhluceothgvrhhrhihpihhnghhmsehgmhgrihhlrdgtohhmqeenucggtffrrghtthgvrhhnpeeitddtheevudeuteeijeeuvdeuteetheetgeehgfejgefftdfhleeludevieetieenucfkphepvddtledrkeehrdduieejrdegjeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhephhgvlhhopehmrghilhdqlhhfuddqfhegjedrghhoohhglhgvrdgtohhmpdhinhgvthepvddtledrkeehrdduieejrdegjedpmhgrihhlfhhrohhmpehtvghrrhihphhinhhgmhesghhmrghilhdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehtrdhpihhnnhgvlhhlsegsthhinhhtvghrnhgvthdrtghomhdprhgvvhfkrfepmhgrihhlqdhlfhduqdhfgeejrdhgohhoghhlvgdrtghomhdpshhpfhepphgrshhspdgukhhimhepfhgrihhlpdhgvghokffrpegfufdpoffvtefjohhstheprhgvqdhprhguqdhrghhinhdqtdduge
>> X-RazorGate-Vade-Verdict: clean 50
>> X-RazorGate-Vade-Classification: clean
>> Received: from mail-lf1-f47.google.com (209.85.167.47) by
>> re-prd-rgin-014.btmx-prd.synchronoss.net (5.8.818)
>> id 647E765D1820188E for (my BT mail address); Mon, 30 Oct 2023
>> 10:01:39 +0000
>> Received: by mail-lf1-f47.google.com with SMTP id
>> 2adb3069b0e04-507c91582fdso6134467e87.2
>> for <(my BT mail address)>; Mon, 30 Oct 2023 03:01:39 -0700
>> (PDT)
>> DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
>> d=gmail.com; s=20230601; t=1698660099; x=1699264899;
>> darn=btinternet.com;
>> h=to:subject:message-id:date:from:mime-version:from:to:cc:subject
>> :date:message-id:reply-to;
>> bh=MJgBuCpOBSnwycoDbV2pkVjPi7Yc7pe/fwjnSg3UY1k=;
>> b=W/BxzXVw1mJc9ja6V9H/zq3XVBHTHGurnavr1RIKJ/7ypqxcQoexvsv8cwJmNubArr
>> nBQ7uUdAH0/FvbxbC+NYGfiimXRFCJoEOCNF/Uzd8412VnBLXgQzdDyHloLteWgJElEq
>> SxjcWbwbSNBRmo2As9Gz1XgTAg+LzKFB9BRvEgVvl/mape7WRh0JLSQiXxxgHCIu5EZo
>> 7B1C00WoULV/q/A07LPM5fgkEChzd6F1eWHAiALTKd8QB51Oa8GxEDnpb+0ONSWYmx8z
>> xREldzaT6IqXfXKu5zzAC3ZpTbpI2agUR5D1VabuWTpD+TvraKDr9ksrERlPtWzPnyDN
>> IvDw==
>> X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
>> d=1e100.net; s=20230601; t=1698660099; x=1699264899;
>> h=to:subject:message-id:date:from:mime-version:x-gm-message-state
>> :from:to:cc:subject:date:message-id:reply-to;
>> bh=MJgBuCpOBSnwycoDbV2pkVjPi7Yc7pe/fwjnSg3UY1k=;
>> b=ZcMurd8iYEkNtrXwdpCtC5HeoQgjjOm/MsjWbxHCN/3975Jfip3eYcVtvXUApJHE0R
>> 1hIpUEQnclw/qAdBqq7OvHnZZD3U48hodz2Yzsj/J6CoipmsmbD4+C6h5S/x5QkzXbkC
>> kmfvtAfLe1FDGxsk6YzyQxPrfPA80DFutgQ30NRUA+PMzIrJbPP1HG1O9W9rEmneYM2j
>> EiJ6BOKTNZaeKSBSNwdjqwhi+mw4Vd9esiBIMLiQZ+h53L/qkEa2jmd3H07S8GVYV0Jd
>> IPDhF8mWyVUTjK0L7plBzapnx7ZzvgJg6pTApJjCgIdsLZjhnNV7Zj6D8s2R1+d+c5E5
>> FXzg==
>> X-Gm-Message-State:
>> AOJu0YxoM2X7Y3mJEtXI3bmBPpbCm23HrwjGZSefXT6AKXdnSqKnfJ+0
>> loV3VLAl5XkuVGlITtmigqj1PO6jFeG31qfGMP1yNC2+024=
>> X-Google-Smtp-Source:
>> AGHT+IETiggGaDcr1amq1L9EAv286pKA9CFP0jrkOITzmxFBJHQqqF7a0hFTetDG37iUJxQGEOH+8UEpBdzfnkcNR/w=
>> X-Received: by 2002:ac2:5183:0:b0:509:1301:8470 with SMTP id
>> u3-20020ac25183000000b0050913018470mr3030416lfi.45.1698660098938; Mon,
>> 30 Oct
>> 2023 03:01:38 -0700 (PDT)
>> MIME-Version: 1.0
>> From: Terry Pinnell <(mygmail address)>
>> Date: Mon, 30 Oct 2023 10:01:28 +0000
>> Message-ID:
>> <CAEU3o8458DBHKx=nEnfjbNnJmXTZXmi6tC5+454ukebfcfdx5A@mail.gmail.com>
>> Subject: From g to b on iPhone
>> To: Terry-BT-email <(my BT mail address)>
>> Content-Type: multipart/alternative;
>> boundary="000000000000caa0730608ec1fe2"
>> X-Agent-Received: from BT (POP) (mail.btinternet.com); Mon, 30 Oct 2023
>> 10:01:45 +0000
>> X-Agent-Junk-Probability: 0


Click here to read the complete article
Re: Puzzle arising re BT ceasing POP support

<0465kip6erp40pnfrbbiftmrsc5cp57sl1@4ax.com>

  copy mid

https://www.rocksolidbbs.com/computers/article-flat.php?id=5399&group=alt.usenet.offline-reader.forte-agent#5399

  copy link   Newsgroups: alt.usenet.offline-reader.forte-agent
Path: i2pn2.org!i2pn.org!eternal-september.org!feeder2.eternal-september.org!news.eternal-september.org!.POSTED!not-for-mail
From: jock@soccer.com (Nobody)
Newsgroups: alt.usenet.offline-reader.forte-agent
Subject: Re: Puzzle arising re BT ceasing POP support
Date: Wed, 01 Nov 2023 11:45:22 -0700
Organization: A noiseless patient Spider
Lines: 56
Message-ID: <0465kip6erp40pnfrbbiftmrsc5cp57sl1@4ax.com>
References: <g48uhihpih66rt69oitqn9fmlsahrbt2v9@4ax.com> <19juhil22ovjreeedkbpdo5ai66ul1c838@4ax.com> <uk80iitap079p59v9nsj4b5eo10mop0gio@4ax.com> <39j0ii5gfn22fe46n8ivdjqu0e0h40c9nn@4ax.com> <4p0vjilf8e9f7uusvsu6pdcor46k06nlhi@4ax.com> <jp54kil6bbk53bebidr8j0enje2a7stlp7@4ax.com> <9kr4kilsgjn2l37fn6b7gpbm6jk91pi164@4ax.com> <q645ki1g1bjkp0t48ps42p3bq2aink1b6v@4ax.com>
MIME-Version: 1.0
Content-Type: text/plain; charset=us-ascii
Content-Transfer-Encoding: 7bit
Injection-Info: dont-email.me; posting-host="f367befc6f6480ff7ae5a70ede0e9605";
logging-data="1841339"; mail-complaints-to="abuse@eternal-september.org"; posting-account="U2FsdGVkX18Pnw7+NZ7XT/XvIDNcSzlC"
User-Agent: ForteAgent/8.00.32.1272
Cancel-Lock: sha1:P48dW2WbVEZIBIKWFS71aRoB92o=
 by: Nobody - Wed, 1 Nov 2023 18:45 UTC

On Wed, 01 Nov 2023 18:03:13 +0000, Terry Pinnell
<me@somewhere.invalid> wrote:

>Nobody <jock@soccer.com> wrote:
>
>>On Wed, 01 Nov 2023 22:15:41 +1300, Ralph Fox <-rf-nz-@-.invalid>
>>wrote:
>>
>>>On Mon, 30 Oct 2023 10:40:42 +0000, Terry Pinnell wrote:
>>>
>>>> I deleted that IMAP account but no change. Still getting duplicates.
>>>> Just sent one to myself. Do the two respective headers help identify the
>>>> cause please?
>>>
>>>Look at these...
>>>
>>> A. First Look at the "X-Agent-Received:" header line, which is added
>>> by Agent when downloading the email.
>>> 1) The first header below was downloaded from Gmail (not from BT).
>>> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>>> X-Agent-Received: from Gmail (POP) (pop.gmail.com); Mon, 30 Oct 2023 10:01:45 +0000
>>> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>>> 2) The second header below was downloaded from BT.
>>> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>>> X-Agent-Received: from BT (POP) (mail.btinternet.com); Mon, 30 Oct 2023 10:01:45 +0000
>>> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>>>
>>> For some reason Gmail is putting a copy of the sent email into
>>> your Gmail POP3 Inbox.
>>
>>Probably because the OP told <gmail> via a login through browser
>>that's what they wanted?
>
>Assuming you're a gmail user can you please tell me how to navigate to
>that setting please? I'm not aware of making any attempt to get Gmail to
>do that.

1. Using your browser, log into your <gmail> account on-line.

2. In the top right of the opening screen, click the *gear
wheel/settings*.

3. You should see a larger dialog box with *Show all settings* --
click.

4. Along the top of the resulting frame will be a large numbers of
possibilities -- click *Forwarding and POP/IMAP*.

5. In *POP download*, the item *3. Configure your email client*
(which in your case is Forte Agent) contains a prompt for
*Configuration Instructions*.

6. Under *IMAP access*, again review the same third-party
*Configuration instructions*.

And don't forget to *Save Changes* if you alter any settings.

Re: Puzzle arising re BT ceasing POP support

<9sg5kidjif250l47sup8ldlqr1e8gke23n@4ax.com>

  copy mid

https://www.rocksolidbbs.com/computers/article-flat.php?id=5400&group=alt.usenet.offline-reader.forte-agent#5400

  copy link   Newsgroups: alt.usenet.offline-reader.forte-agent
Path: i2pn2.org!i2pn.org!eternal-september.org!feeder2.eternal-september.org!eternal-september.org!fu-berlin.de!uni-berlin.de!individual.net!not-for-mail
From: me@somewhere.invalid (Terry Pinnell)
Newsgroups: alt.usenet.offline-reader.forte-agent
Subject: Re: Puzzle arising re BT ceasing POP support
Date: Wed, 01 Nov 2023 21:32:54 +0000
Lines: 86
Message-ID: <9sg5kidjif250l47sup8ldlqr1e8gke23n@4ax.com>
References: <g48uhihpih66rt69oitqn9fmlsahrbt2v9@4ax.com> <19juhil22ovjreeedkbpdo5ai66ul1c838@4ax.com> <uk80iitap079p59v9nsj4b5eo10mop0gio@4ax.com> <39j0ii5gfn22fe46n8ivdjqu0e0h40c9nn@4ax.com> <4p0vjilf8e9f7uusvsu6pdcor46k06nlhi@4ax.com> <jp54kil6bbk53bebidr8j0enje2a7stlp7@4ax.com> <9kr4kilsgjn2l37fn6b7gpbm6jk91pi164@4ax.com> <q645ki1g1bjkp0t48ps42p3bq2aink1b6v@4ax.com> <0465kip6erp40pnfrbbiftmrsc5cp57sl1@4ax.com>
Mime-Version: 1.0
Content-Type: text/plain; charset=us-ascii
Content-Transfer-Encoding: 7bit
X-Trace: individual.net H248qV2kbGoR6X9NDoSXRgaNPQbV9c9W+C0ZNY/ZE458nKie44
Cancel-Lock: sha1:76MsqO+0VsOfKQexEsaWJu/g+xU= sha256:ayAKa5vymrXui1dMNwFChbcGjlJBnMPulCRyUNbEbLE=
X-Newsreader: Forte Agent 4.2/32.1118
 by: Terry Pinnell - Wed, 1 Nov 2023 21:32 UTC

Nobody <jock@soccer.com> wrote:

>On Wed, 01 Nov 2023 18:03:13 +0000, Terry Pinnell
><me@somewhere.invalid> wrote:
>
>>Nobody <jock@soccer.com> wrote:
>>
>>>On Wed, 01 Nov 2023 22:15:41 +1300, Ralph Fox <-rf-nz-@-.invalid>
>>>wrote:
>>>
>>>>On Mon, 30 Oct 2023 10:40:42 +0000, Terry Pinnell wrote:
>>>>
>>>>> I deleted that IMAP account but no change. Still getting duplicates.
>>>>> Just sent one to myself. Do the two respective headers help identify the
>>>>> cause please?
>>>>
>>>>Look at these...
>>>>
>>>> A. First Look at the "X-Agent-Received:" header line, which is added
>>>> by Agent when downloading the email.
>>>> 1) The first header below was downloaded from Gmail (not from BT).
>>>> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>>>> X-Agent-Received: from Gmail (POP) (pop.gmail.com); Mon, 30 Oct 2023 10:01:45 +0000
>>>> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>>>> 2) The second header below was downloaded from BT.
>>>> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>>>> X-Agent-Received: from BT (POP) (mail.btinternet.com); Mon, 30 Oct 2023 10:01:45 +0000
>>>> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>>>>
>>>> For some reason Gmail is putting a copy of the sent email into
>>>> your Gmail POP3 Inbox.
>>>
>>>Probably because the OP told <gmail> via a login through browser
>>>that's what they wanted?
>>
>>Assuming you're a gmail user can you please tell me how to navigate to
>>that setting please? I'm not aware of making any attempt to get Gmail to
>>do that.
>
>1. Using your browser, log into your <gmail> account on-line.
>
>2. In the top right of the opening screen, click the *gear
>wheel/settings*.
>
>3. You should see a larger dialog box with *Show all settings* --
>click.
>
>4. Along the top of the resulting frame will be a large numbers of
>possibilities -- click *Forwarding and POP/IMAP*.
>
>5. In *POP download*, the item *3. Configure your email client*
>(which in your case is Forte Agent) contains a prompt for
>*Configuration Instructions*.
>
>6. Under *IMAP access*, again review the same third-party
>*Configuration instructions*.
>
>And don't forget to *Save Changes* if you alter any settings.

Thanks, appreciate your help. I have taken those steps on several
occasions. I'm pretty sure I've done it accurately but the duplicates
remain.

One instruction I haven't taken precisely is:
"4. In the 'POP download' section, select Enable POP for all mail or
Enable POP for mail that arrives from now on." I assume they are
over-ridden by "1. Status: *POP is enabled* for all mail that has
arrived since 5 Oct." Do you agree?

Similarly, I have just checked again that my Agent settings for Gmail
are correct. (The Agent dialog window differs a bit, but I see no issue
there.)

I'm also using 'Recent mode', but that too seems irrelevant.

Similarly, I'm forced to use an 'Application-specific password' in
Agent.

I send myself emails from Agent covering all four combinations: BT to
GM, BT to BT, GM to BT, GM to GM. I only get GM to BT duplicated in the
Agent Inbox. GMail in Chrome, and (iOS) Mail on iPad receives the set of
four with no duplication.

So, WIP!

Terry

Re: Puzzle arising re BT ceasing POP support

<npg7kilqoq7fdhvd6usqp6du95fc7u7vbs@4ax.com>

  copy mid

https://www.rocksolidbbs.com/computers/article-flat.php?id=5401&group=alt.usenet.offline-reader.forte-agent#5401

  copy link   Newsgroups: alt.usenet.offline-reader.forte-agent
Path: i2pn2.org!i2pn.org!eternal-september.org!feeder2.eternal-september.org!news.eternal-september.org!.POSTED!not-for-mail
From: jock@soccer.com (Nobody)
Newsgroups: alt.usenet.offline-reader.forte-agent
Subject: Re: Puzzle arising re BT ceasing POP support
Date: Thu, 02 Nov 2023 08:49:24 -0700
Organization: A noiseless patient Spider
Lines: 100
Message-ID: <npg7kilqoq7fdhvd6usqp6du95fc7u7vbs@4ax.com>
References: <g48uhihpih66rt69oitqn9fmlsahrbt2v9@4ax.com> <19juhil22ovjreeedkbpdo5ai66ul1c838@4ax.com> <uk80iitap079p59v9nsj4b5eo10mop0gio@4ax.com> <39j0ii5gfn22fe46n8ivdjqu0e0h40c9nn@4ax.com> <4p0vjilf8e9f7uusvsu6pdcor46k06nlhi@4ax.com> <jp54kil6bbk53bebidr8j0enje2a7stlp7@4ax.com> <9kr4kilsgjn2l37fn6b7gpbm6jk91pi164@4ax.com> <q645ki1g1bjkp0t48ps42p3bq2aink1b6v@4ax.com> <0465kip6erp40pnfrbbiftmrsc5cp57sl1@4ax.com> <9sg5kidjif250l47sup8ldlqr1e8gke23n@4ax.com>
MIME-Version: 1.0
Content-Type: text/plain; charset=us-ascii
Content-Transfer-Encoding: 7bit
Injection-Info: dont-email.me; posting-host="6cc04767363efe9902fd84e9a80da1de";
logging-data="2404197"; mail-complaints-to="abuse@eternal-september.org"; posting-account="U2FsdGVkX18eLbGjUNGrMGlRrufQ/Ge6"
User-Agent: ForteAgent/8.00.32.1272
Cancel-Lock: sha1:ZpE5Wm7eBNipoz+/5oRYmsObSAg=
 by: Nobody - Thu, 2 Nov 2023 15:49 UTC

On Wed, 01 Nov 2023 21:32:54 +0000, Terry Pinnell
<me@somewhere.invalid> wrote:

>Nobody <jock@soccer.com> wrote:
>
>>On Wed, 01 Nov 2023 18:03:13 +0000, Terry Pinnell
>><me@somewhere.invalid> wrote:
>>
>>>Nobody <jock@soccer.com> wrote:
>>>
>>>>On Wed, 01 Nov 2023 22:15:41 +1300, Ralph Fox <-rf-nz-@-.invalid>
>>>>wrote:
>>>>
>>>>>On Mon, 30 Oct 2023 10:40:42 +0000, Terry Pinnell wrote:
>>>>>
>>>>>> I deleted that IMAP account but no change. Still getting duplicates.
>>>>>> Just sent one to myself. Do the two respective headers help identify the
>>>>>> cause please?
>>>>>
>>>>>Look at these...
>>>>>
>>>>> A. First Look at the "X-Agent-Received:" header line, which is added
>>>>> by Agent when downloading the email.
>>>>> 1) The first header below was downloaded from Gmail (not from BT).
>>>>> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>>>>> X-Agent-Received: from Gmail (POP) (pop.gmail.com); Mon, 30 Oct 2023 10:01:45 +0000
>>>>> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>>>>> 2) The second header below was downloaded from BT.
>>>>> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>>>>> X-Agent-Received: from BT (POP) (mail.btinternet.com); Mon, 30 Oct 2023 10:01:45 +0000
>>>>> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>>>>>
>>>>> For some reason Gmail is putting a copy of the sent email into
>>>>> your Gmail POP3 Inbox.
>>>>
>>>>Probably because the OP told <gmail> via a login through browser
>>>>that's what they wanted?
>>>
>>>Assuming you're a gmail user can you please tell me how to navigate to
>>>that setting please? I'm not aware of making any attempt to get Gmail to
>>>do that.
>>
>>1. Using your browser, log into your <gmail> account on-line.
>>
>>2. In the top right of the opening screen, click the *gear
>>wheel/settings*.
>>
>>3. You should see a larger dialog box with *Show all settings* --
>>click.
>>
>>4. Along the top of the resulting frame will be a large numbers of
>>possibilities -- click *Forwarding and POP/IMAP*.
>>
>>5. In *POP download*, the item *3. Configure your email client*
>>(which in your case is Forte Agent) contains a prompt for
>>*Configuration Instructions*.
>>
>>6. Under *IMAP access*, again review the same third-party
>>*Configuration instructions*.
>>
>>And don't forget to *Save Changes* if you alter any settings.
>
>Thanks, appreciate your help. I have taken those steps on several
>occasions. I'm pretty sure I've done it accurately but the duplicates
>remain.
>
>One instruction I haven't taken precisely is:
>"4. In the 'POP download' section, select Enable POP for all mail or
>Enable POP for mail that arrives from now on." I assume they are
>over-ridden by "1. Status: *POP is enabled* for all mail that has
>arrived since 5 Oct." Do you agree?

I would suspect/agree you need to use the *dated* setting as I presume
that's the calendar date BT ceased its POP support?

>
>Similarly, I have just checked again that my Agent settings for Gmail
>are correct. (The Agent dialog window differs a bit, but I see no issue
>there.)
>
>I'm also using 'Recent mode', but that too seems irrelevant.
>
>Similarly, I'm forced to use an 'Application-specific password' in
>Agent.
>
>I send myself emails from Agent covering all four combinations: BT to
>GM, BT to BT, GM to BT, GM to GM. I only get GM to BT duplicated in the
>Agent Inbox. GMail in Chrome, and (iOS) Mail on iPad receives the set of
>four with no duplication.
>
>So, WIP!
>
>Terry

Given <gmail> is IMAP and (as with myself from my original British
Columbian telco ISP domain address now "powered by Gmail") I have my
Thunderbird client set up with both POP and IMAP accounts on my PC.

I wonder if you should review all the cross-settings in Gmail's
*Labels*, another of the choices available in my original Hint 4?


computers / alt.usenet.offline-reader.forte-agent / Re: Puzzle arising re BT ceasing POP support

1
server_pubkey.txt

rocksolid light 0.9.81
clearnet tor