Ralph Fox <-rf-nz-@-.invalid> wrote:

>On Mon, 30 Oct 2023 10:40:42 +0000, Terry Pinnell wrote:
>
>> I deleted that IMAP account but no change. Still getting duplicates.
>> Just sent one to myself. Do the two respective headers help identify the
>> cause please?
>
>Look at these...
>
> A. First Look at the "X-Agent-Received:" header line, which is added
> by Agent when downloading the email.
> 1) The first header below was downloaded from Gmail (not from BT).
> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
> X-Agent-Received: from Gmail (POP) (pop.gmail.com); Mon, 30 Oct 2023 10:01:45 +0000
> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
> 2) The second header below was downloaded from BT.
> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
> X-Agent-Received: from BT (POP) (mail.btinternet.com); Mon, 30 Oct 2023 10:01:45 +0000
> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>
> For some reason Gmail is putting a copy of the sent email into
> your Gmail POP3 Inbox. This is where Agent gets the first copy
> below from.
> * Perhaps your iOS mail app is configured to Bcc a copy of the
> email to your Gmail account.
> * If it is not your own iOS mail app settings, it might be your
> Gmail account settings. However, I am not aware of a Gmail
> account setting which would do this.
>
> Ultimately it would be settings you control which are putting a
> copy of the email into your Gmail inbox in addition to sending
> the email to your BT inbox. The headers don't tell me which
> settings are doing this, only that this is what is going on.
>
Thanks Ralph, I'm sure you're right, but so far I haven't discovered the
relevant setting.

>
> B. Now look at all the "Received:" header lines in each header.
> These, read from bottom to top, show the email hopping from
> server to server on its way to the destination.
> 1) The first header below has no "Received:" header lines.
> This means it has not gone anywhere. You posted it from
> your Gmail account, and this copy was still in your Gmail
> account from where Agent downloaded it.
> 2) The second header below has these three "Received:" header
> lines:
> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
> Received: from re-prd-rgin-014.btmx-prd.synchronoss.net ([10.2.54.22])
> by re-prd-fep-014.mx.internal with ESMTP
> id <20231030100139.PYSN12241.re-prd-fep-014.mx.internal@re-prd-rgin-014.btmx-prd.synchronoss.net>
> for <(my BT mail address)>; Mon, 30 Oct 2023 10:01:39 +0000
> Received: from mail-lf1-f47.google.com (209.85.167.47) by re-prd-rgin-014.btmx-prd.synchronoss.net (5.8.818)
> id 647E765D1820188E for (my BT mail address); Mon, 30 Oct 2023 10:01:39 +0000
> Received: by mail-lf1-f47.google.com with SMTP id 2adb3069b0e04-507c91582fdso6134467e87.2
> for <(my BT mail address)>; Mon, 30 Oct 2023 03:01:39 -0700 (PDT)
> ~~~~~~~~~~~~~~~~~~~~~~~~ QUOTE ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>
> These header lines must be read from bottom to top.
> * The bottom "Received:" header is your email hopping
> from one Google server to another, from where it will
> then be sent off to BT.
> * The middle "Received:" header is your email hopping
> from a Google server to a BT mail exchange (mx) server.
> * The top "Received:" header is your email hopping from
> the BT mail exchange (mx) server to the server where
> your BT inbox lives.
>
>______________________________________________________________________
>
>> MIME-Version: 1.0
>> Date: Mon, 30 Oct 2023 10:01:28 +0000
>> Message-ID:
>> <CAEU3o8458DBHKx=nEnfjbNnJmXTZXmi6tC5+454ukebfcfdx5A@mail.gmail.com>
>> Subject: From g to b on iPhone
>> From: Terry Pinnell <(mygmail address)>
>> To: Terry-BT-email <(my BT mail address)>
>> Content-Type: multipart/alternative;
>> boundary="0000000000002a685c0608ec1f1e"
>> X-Agent-Received: from Gmail (POP) (pop.gmail.com); Mon, 30 Oct 2023
>> 10:01:45 +0000
>> X-Agent-Junk-Probability: 0
>>
>> ====================
>>
>> Return-Path: <(mygmail address)>
>> Received: from re-prd-rgin-014.btmx-prd.synchronoss.net ([10.2.54.22])
>> by re-prd-fep-014.mx.internal with ESMTP
>> id
>> <20231030100139.PYSN12241.re-prd-fep-014.mx.internal@re-prd-rgin-014.btmx-prd.synchronoss.net>
>> for <(my BT mail address)>; Mon, 30 Oct 2023 10:01:39 +0000
>> Authentication-Results: btinternet.com;
>> dmarc=pass header.from=gmail.com;
>> dkim=fail;
>> spf=none smtp.helo=mail-lf1-f47.google.com;
>> spf=pass smtp.mailfrom=gmail.com;
>> bimi=skipped
>> X-OWM-SPF-MAILFROM: Pass
>> X-OWM-SPF: 0
>> Received-SPF: none (re-prd-rgin-014.btmx-prd.synchronoss.net: domain
>> mail-lf1-f47.google.com does not designate permitted sender hosts)
>> identity=helo; receiver=re-prd-rgin-014.btmx-prd.synchronoss.net;
>> client-ip=209.85.167.47; helo=mail-lf1-f47.google.com;
>> Received-SPF: pass (re-prd-rgin-014.btmx-prd.synchronoss.net: domain
>> gmail.com
>> designates 209.85.167.47 as permitted sender) identity=mailfrom;
>> receiver=re-prd-rgin-014.btmx-prd.synchronoss.net;
>> client-ip=209.85.167.47;
>> envelope-from=(mygmail address); helo=mail-lf1-f47.google.com;
>> X-Originating-IP: [209.85.167.47]
>> X-OWM-Source-IP: 209.85.167.47 (US)
>> X-OWM-Env-Sender: (mygmail address)
>> X-SNCR-Rigid: 647E765D1820188E
>> X-OWM-DMARC: spf 0 dkim 7
>> X-OWM-DKIM: 2
>> X-VadeSecure-score: verdict=clean score=50/320, class=clean
>> X-SNCR-VADESECURE: CLEAN
>> X-RazorGate-Vade:
>> gggruggvucftvghtrhhoucdtuddrgedvkedruddttddgtdelucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuueftkffvkffujffvgffngfevqffonecuuegrihhlohhuthemuceftddunecugfhmphhthicusghougihucdlhedtmdenucfjughrpegghfffkffuvfgtsegrtderredttdejnecuhfhrohhmpefvvghrrhihucfrihhnnhgvlhhluceothgvrhhrhihpihhnghhmsehgmhgrihhlrdgtohhmqeenucggtffrrghtthgvrhhnpeeitddtheevudeuteeijeeuvdeuteetheetgeehgfejgefftdfhleeludevieetieenucfkphepvddtledrkeehrdduieejrdegjeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhephhgvlhhopehmrghilhdqlhhfuddqfhegjedrghhoohhglhgvrdgtohhmpdhinhgvthepvddtledrkeehrdduieejrdegjedpmhgrihhlfhhrohhmpehtvghrrhihphhinhhgmhesghhmrghilhdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehtrdhpihhnnhgvlhhlsegsthhinhhtvghrnhgvthdrtghomhdprhgvvhfkrfepmhgrihhlqdhlfhduqdhfgeejrdhgohhoghhlvgdrtghomhdpshhpfhepphgrshhspdgukhhimhepfhgrihhlpdhgvghokffrpegfufdpoffvtefjohhstheprhgvqdhprhguqdhrghhinhdqtdduge
>> X-RazorGate-Vade-Verdict: clean 50
>> X-RazorGate-Vade-Classification: clean
>> Received: from mail-lf1-f47.google.com (209.85.167.47) by
>> re-prd-rgin-014.btmx-prd.synchronoss.net (5.8.818)
>> id 647E765D1820188E for (my BT mail address); Mon, 30 Oct 2023
>> 10:01:39 +0000
>> Received: by mail-lf1-f47.google.com with SMTP id
>> 2adb3069b0e04-507c91582fdso6134467e87.2
>> for <(my BT mail address)>; Mon, 30 Oct 2023 03:01:39 -0700
>> (PDT)
>> DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
>> d=gmail.com; s=20230601; t=1698660099; x=1699264899;
>> darn=btinternet.com;
>> h=to:subject:message-id:date:from:mime-version:from:to:cc:subject
>> :date:message-id:reply-to;
>> bh=MJgBuCpOBSnwycoDbV2pkVjPi7Yc7pe/fwjnSg3UY1k=;
>> b=W/BxzXVw1mJc9ja6V9H/zq3XVBHTHGurnavr1RIKJ/7ypqxcQoexvsv8cwJmNubArr
>> nBQ7uUdAH0/FvbxbC+NYGfiimXRFCJoEOCNF/Uzd8412VnBLXgQzdDyHloLteWgJElEq
>> SxjcWbwbSNBRmo2As9Gz1XgTAg+LzKFB9BRvEgVvl/mape7WRh0JLSQiXxxgHCIu5EZo
>> 7B1C00WoULV/q/A07LPM5fgkEChzd6F1eWHAiALTKd8QB51Oa8GxEDnpb+0ONSWYmx8z
>> xREldzaT6IqXfXKu5zzAC3ZpTbpI2agUR5D1VabuWTpD+TvraKDr9ksrERlPtWzPnyDN
>> IvDw==
>> X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
>> d=1e100.net; s=20230601; t=1698660099; x=1699264899;
>> h=to:subject:message-id:date:from:mime-version:x-gm-message-state
>> :from:to:cc:subject:date:message-id:reply-to;
>> bh=MJgBuCpOBSnwycoDbV2pkVjPi7Yc7pe/fwjnSg3UY1k=;
>> b=ZcMurd8iYEkNtrXwdpCtC5HeoQgjjOm/MsjWbxHCN/3975Jfip3eYcVtvXUApJHE0R
>> 1hIpUEQnclw/qAdBqq7OvHnZZD3U48hodz2Yzsj/J6CoipmsmbD4+C6h5S/x5QkzXbkC
>> kmfvtAfLe1FDGxsk6YzyQxPrfPA80DFutgQ30NRUA+PMzIrJbPP1HG1O9W9rEmneYM2j
>> EiJ6BOKTNZaeKSBSNwdjqwhi+mw4Vd9esiBIMLiQZ+h53L/qkEa2jmd3H07S8GVYV0Jd
>> IPDhF8mWyVUTjK0L7plBzapnx7ZzvgJg6pTApJjCgIdsLZjhnNV7Zj6D8s2R1+d+c5E5
>> FXzg==
>> X-Gm-Message-State:
>> AOJu0YxoM2X7Y3mJEtXI3bmBPpbCm23HrwjGZSefXT6AKXdnSqKnfJ+0
>> loV3VLAl5XkuVGlITtmigqj1PO6jFeG31qfGMP1yNC2+024=
>> X-Google-Smtp-Source:
>> AGHT+IETiggGaDcr1amq1L9EAv286pKA9CFP0jrkOITzmxFBJHQqqF7a0hFTetDG37iUJxQGEOH+8UEpBdzfnkcNR/w=
>> X-Received: by 2002:ac2:5183:0:b0:509:1301:8470 with SMTP id
>> u3-20020ac25183000000b0050913018470mr3030416lfi.45.1698660098938; Mon,
>> 30 Oct
>> 2023 03:01:38 -0700 (PDT)
>> MIME-Version: 1.0
>> From: Terry Pinnell <(mygmail address)>
>> Date: Mon, 30 Oct 2023 10:01:28 +0000
>> Message-ID:
>> <CAEU3o8458DBHKx=nEnfjbNnJmXTZXmi6tC5+454ukebfcfdx5A@mail.gmail.com>
>> Subject: From g to b on iPhone
>> To: Terry-BT-email <(my BT mail address)>
>> Content-Type: multipart/alternative;
>> boundary="000000000000caa0730608ec1fe2"
>> X-Agent-Received: from BT (POP) (mail.btinternet.com); Mon, 30 Oct 2023
>> 10:01:45 +0000
>> X-Agent-Junk-Probability: 0

Bewildering. Roll on AI; I'll tell it what I want to happen in plain
english ;-)

Terry